SIGLEC7 anticorps (Middle Region)

N° du produit ABIN634724

L’anticorps Lapin Polyclonal anti-SIGLEC7 a été validé pour WB. Il convient pour détecter SIGLEC7 dans des échantillons de Humain.

Aperçu rapide pour SIGLEC7 anticorps (Middle Region) (ABIN634724)

Antigène: SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIGLEC7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SIGLEC7 anticorps

Épitope: Middle Region

Specificité: SIGLEC7 antibody was raised against the middle region of SIGLEC7

Purification: Affinity purified

Immunogène: SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SIGLEC7 Blocking Peptide, (ABIN935959), is also available for use as a blocking control in assays to test for specificity of this SIGLEC7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIGLEC7

Antigène: SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))

Autre désignation: SIGLEC7

Sujet: SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. In the immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.

Poids moléculaire: 51 kDa (MW of target protein)